Anti-AGTPBP1 (CCP1, KIAA1035, NNA1, Cytosolic Carboxypeptidase 1, ATP/GTP-binding Protein 1, Nervous System Nuclear Protein Induced by Axotomy Protein 1 Homolog) (PE) Monoclonal Antibody
Cat# 123075-PE-100ul
Size : 100ul
Brand : US Biological
123075-PE AGTPBP1 (CCP1, KIAA1035, NNA1, Cytosolic Carboxypeptidase 1, ATP/GTP-binding Protein 1, Nervous System Nuclear Protein Induced by Axotomy Protein 1 Homolog) (PE)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_015239, NP_056054Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeNNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.
Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
GAKFCVGLLRLKRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSELSRTYLP*
Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.