Crustacean Hyperglycemic Hormones, Recombinant, Carcinus maenas, aa67-138, His-Tag, Myc-Tag

Cat# 584102-20ug

Size : 20ug

Brand : US Biological

Request more information



584102 Crustacean Hyperglycemic Hormones, Recombinant, Carcinus maenas, aa67-138, His-Tag, Myc-Tag

Clone Type
Polyclonal
Swiss Prot
P14944
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.

Source:
Recombinant protein corresponding to aa67-138 from Carcinus maenas Crustacean hyperglycemic hormones, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.

Molecular Weight:
~16.0kD

Amino Acid Sequence:
QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)