SARS-CoV-2 ORF10 Gene Tagged ORF (codon optimized)

CAT#: VC102564

  • TrueORF®

Myc-DDK-tagged ORF clone for SARS-CoV-2 ORF10 protein [Severe acute respiratory syndrome coronavirus 2], codon optimized for human cell expression, YP_009725255


Product Images

Specifications

Product Data
Tag Myc-DDK
Symbol ORF10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC102564 represents NCBI reference of YP_009725255 with codon optimized for human cell expression
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGGCTACATAAATGTCTTCGCTTTCCCTTTCACAATTTACTCACTTCTCCTCTGCCGCATGAACTCT
AGAAACTATATTGCTCAAGTCGACGTCGTTAATTTTAATCTCACC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>VC102564 representing YP_009725255
Blue=ORF Red=Cloning site Green=Tag(s)

MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_045512
ORF Size 114 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NC_045512.2, YP_009725255
RefSeq ORF 114 bp
MW 4.4 kDa

Other Versions