Gonadotropin Releasing Hormone (GnRH) Recombinant, Human

Cat# 154883-10ug

Size : 10ug

Brand : US Biological

Request more information



154883 Gonadotropin Releasing Hormone (GnRH) Recombinant, Human

Clone Type
Polyclonal
Swiss Prot
P01148
Grade
Highly Purified
Shipping Temp
Blue Ice
Storage Temp
4°C/-70°C

Source:|Recombinant Human from E. coli||Accession No:|P01148||Fragment:|Gln24~Ile92 (Accession No: P01148)||Sequence:|MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-QHWSYGL RPGGKRDAEN LIDSFQEIVK EVGQLAETQR FECTTHQPRS PLRDLKGALE SLIEEETGQK KI||Epitope Tag:|N-terminal Tags: His-tag and S-tag||Molecular Weight:|13.6kD||Applications:|Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE.|Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||Storage and Stability:|Lyophilized and reconstituted products are stable for 6 months after receipt at -70°C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.||Note:|Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.

Applications
Source: Recombinant, E. coli|Purity: ≥95%. Endotoxin: ≤1EU/ug (LAL). |Form: Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as lyophilized powder from PBS, pH 7.4, 1mM DTT, 5% trehalose, 0.01% sarcosyl, 0.05% Proclin-300. Reconstitute with sterile PBS to a concentration of 0.1-1mg/ml. Do not vortex.
Purity
≥95%. Endotoxin: ≤1EU/ug (LAL).