Recombinant Human LR3 Insulin-Like Growth Factor I/LR3-IGF-1 (MG)

Size : 50ug
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 300mM HAc-NaAc, pH 6.5. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 500mM Acetic Acid. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.05 ng/µg (0.5 IEU/µg) as determined by LAL test.
Biological Activity : ED50 is greater than 200 ng/ml.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
BioGrid: | 109700. 13 interactions. |
There are currently no product reviews |