- More Files
- Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Ift80.
Immunogen
Recombinant GST fusion protein corresponding to 134 amino acids of mouse Ift80.
Sequence
KNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKK
Host
Rabbit
Reactivity
Mouse
Specificity
Specific to recombinant protein GX0752. This antibody detects mIFT80 protein.
Form
Liquid
Purification
Affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Applications
Western Blot
- Gene Info — Ift80
- Publication Reference
- IFT80 promotes early bone healing of tooth sockets through the activation of TAZ/RUNX2 pathway.
Ziwei Zhao, Ying Geng, Qiaoqi Ni, Yue Chen, Yanan Cao, Yahui Lu, Hua Wang, Ruixia Wang, Wen Sun.
Oral Diseases 2024 Jan; [Epub].
Application:ICC, IF, WB, Mouse, C3H10T1/2 cell lines, mouse tooth.
- Diabetes impairs fracture healing through Foxo1 mediated disruption of ciliogenesis.
Zahra Chinipardaz, Gongsheng Yuan, Min Liu, Dana T Graves, Shuying Yang.
Cell Death Discovery 2023 Aug; 9(1):299.
Application:WB, Mouse, Bone.
- Diabetes Impairs Fracture Healing Through Disruption Of Cilia Formation In Osteoblasts.
Zahra Chinipardaz, Min Liu, Dana Graves, Shuying Yang.
Bone 2021 Dec; 153:116176.
Application:WB-Ti, Mouse, Mouse femur fracture calluses.
- IFT80 Is Required for Fracture Healing Through Controlling the Regulation of TGF-β Signaling in Chondrocyte Differentiation and Function.
Liu M, Alharbi M, Graves D, Yang S.
Journal of Bone and Mineral Research 2020 Mar; 35(3):571.
Application:WB-Ti, Mouse, Mouse femur.
- Ciliary IFT80 regulates dental pulp stem cells differentiation by FGF/FGFR1 and Hh/BMP2 signaling.
Yuan X, Liu M, Cao X, Yang S.
International Journal of Biological Sciences 2019 Aug; 15(10):2087.
Application:WB-Ce, Mouse, Dental pulp stem cells.
- IFT80 is required for stem cell proliferation, differentiation, and odontoblast polarization during tooth development.
Yuan X, Cao X, Yang S.
Cell Death & Disease 2019 Jan; 10(2):63.
Application:WB, Mouse, Mouse dental pulp stem cells.
- IFT80 Improves Invasion Ability in Gastric Cancer Cell Line via ift80/p75NGFR/MMP9 Signaling.
Wang R, Deng X, Yuan C, Xin H, Liu G, Zhu Y, Jiang X, Wang C.
International Journal of Molecular Sciences 2018 Nov; 19(11):E3616.
Application:IF, Human, SGC-7901 cells.
- IFT80 is essential for chondrocyte differentiation by regulating hedgehog and Wnt signaling pathways.
Wang C, Yuan X, Yang S.
Experimental Cell Research 2013 Jan; 319(5):623.
Application:WB, IF, Mouse, Mouse tibia, bonemarrowderivedstromalcells (BMSCs).
- The intraflagellar transport protein IFT80 is required for cilia formation and osteogenesis.
Yang S, Wang C.
Bone 2012 Sep; 51(3):407.
Application:IF, IHC, WB, Mouse, C3H10T1/2 cells, Mouse bone, eye, kidney.
- Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, Kikuno R, Ohara R, Inamoto S, Aizawa H, Yuasa S, Nakajima D, Nagase T, Ohara O, Koga H.
DNA Res 2003 Feb; 10(1):35.
- IFT80 promotes early bone healing of tooth sockets through the activation of TAZ/RUNX2 pathway.