- More Files
- Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KLF10.
Immunogen
KLF10 (AAH11538.1, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (81); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Tissue lysate)
KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in human colon.Western Blot (Cell lysate)
KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Y-79 ( Cat # L042V1 ).Western Blot (Cell lysate)
KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Jurkat(Cat # L017V1 ).Western Blot (Cell lysate)
KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in A-549 ( Cat # L025V1 ).Western Blot (Recombinant protein)
ELISA
- Gene Info — KLF10
Entrez GeneID
7071GeneBank Accession#
BC011538Protein Accession#
AAH11538.1Gene Name
KLF10
Gene Alias
EGRA, TIEG, TIEG1
Gene Description
Kruppel-like factor 10
Omim ID
601878Gene Ontology
HyperlinkOther Designations
TGFB inducible early growth response
- Interactome
- Disease