Western Blot (Cell lysate)
VASH1 monoclonal antibody (M05), clone 4A3. Western Blot analysis of VASH1 expression in HepG2(Cat # L019V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to VASH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VASH1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant VASH1.
Immunogen
VASH1 (NP_055724, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (81)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
VASH1 monoclonal antibody (M05), clone 4A3. Western Blot analysis of VASH1 expression in HepG2(Cat # L019V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to VASH1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VASH1 is 0.03 ng/ml as a capture antibody.ELISA
- Gene Info — VASH1
- Interactomes
- Publication Reference
- Elevated serum vasohibin-1 levels in atopic dermatitis: Implications for disease chronicity.
Haruka Taira, Yukiko Ito, Toyoki Yamamoto, Asumi Koyama, Lixin Li, Eiki Sugimoto, Yuka Mizuno, Kentaro Awaji, Shinichi Sato, Sayaka Shibata.
J Dermatol. 2024 May; Epub:0.
Application：IHC, Human, Skin.
- Tregs are involved in VEGFA/ VASH1-related angiogenesis pathway in ovarian cancer.
Sijing Qiao, Yue Hou, Qing Rong, Bing Han, Peishu Liu.
Translational Oncology 2023 Jun; 32:101665.
Application：IHC-P, Human, Human ovarian cancer.
- Clinicopathological Role of Vasohibin in Gastroenterological Cancers: A Meta-Analysis.
Miho Yamamoto, Soji Ozawa, Kazuo Koyanagi, Yamato Ninomiya, Hitoshi Hara, Akihito Kazuno, Kentaro Yatabe, Tadashi Higuchi, Kenji Nakamura, Kazuhito Nabeshima, Yasufumi Sato.
The Tohoku Journal of Experimental Medicine 2022 Apr; 256(4):291.
Application：IHC, Human, Human colorectal carcinoma, Human esophageal carcinoma, Human hepatocellular carcinoma.
- Keratin 19 as a key molecule in progression of human hepatocellular carcinomas through invasion and angiogenesis.
Takano M, Shimada K, Fujii T, Morita K, Takeda M, Nakajima Y, Nonomura A, Konishi N, Obayashi C.
BMC Cancer 2016 Nov; 16(1):903.
Application：IHC-P, Human, Human hepatocellular carcinoma.
- Vasohibin-1 increases the malignant potential of colorectal cancer and is a biomarker of poor prognosis.
Kitajima T, Toiyama Y, Tanaka K, Saigusa S, Kobayashi M, Inoue Y, Mohri Y, Kusunoki M.
Anticancer Research 2014 Oct; 34(10):5321.
Application：IHC-P, WB-Tr, Human, Colorectal cancer, Caco2, DLD1, HT29, LoVo, SW480 cells.
- Upregulation of vasohibin-1 expression with angiogenesis and poor prognosis of hepatocellular carcinoma after curative surgery.
Wang Q, Tian X, Zhang C, Wang Q.
Medical Oncology 2012 Dec; 29(4):2727.
Application：IHC-P, Human, Hepatocellular carcinoma, Liver.
- Elevated serum vasohibin-1 levels in atopic dermatitis: Implications for disease chronicity.