Anti-AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705) (Biotin) Monoclonal Antibody
Cat# 123114-Biotin-100ul
Size : 100ul
Brand : US Biological
123114-Biotin AIP1 (MAGI2, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 2, Atrophin-1-interacting Protein 1, AIP-1, Atrophin-1-interacting Protein A, Membrane-associated Guanylate Kinase Inverted 2, MAGI-2, ACVRINP1, KIAA0705) (Biotin)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
ECrossreactivity
HuAccession #
NM_012301Shipping Temp
Blue IceStorage Temp
-20°CAtrophin-1 (AIP1) contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. This protein is brain specific, where it appears to be widely expressed in both neurons and glia.||Applications:|Suitable for use in ELISA. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. ||Note: Applications are based on unconjugated antibody.