Anti-Axl (AXL Oncogene, AXL Receptor Tyrosine Kinase, AXL Transforming Gene, AXL Transforming Sequence/gene, Adhesion-related Kinase, Ark, Oncogene AXL, Tyrosine Protein Kinase Receptor, UFO, TYR07) (APC) Monoclonal Antibody

AXL is an 887aa proto-oncogene belonging to the protein kinase super family with a protein kinase domain, two Ig-like C2-type (immunoglobulin-like) domains and two fibronectin type–III domains. Unlike other receptor tyrosine kinases, AXL represents a unique novel structure in the extracellular region that juxtaposes IgL and FNIII repeats. AXL may function as a signal transducer between specific cell types of mesodermal origin and may transduce signals from the extracellular matrix into the cytoplasm by binding to growth factors like vitamin K-dependent protein growth-arrest-specific gene 6 (GAS6) and thus form heterodimer and heterotetramer. It plays an important role in the stimulation of cell proliferation and can also mediate cell aggregation by homophilic binding. In the case of filovirus infection, AXL seems to function as a cell entry factor. Studies reveal the transforming potential of AXL in patients with chronic myeloproliferative disorder or chronic myelocytic leukemia.||Applications:|Suitable for use in FLISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|TQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.