Reagents and instruments for immunology, cell biology and molecular biology.
 
> Anti-KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (Biotin) Monoclonal Antibody

Anti-KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (Biotin) Monoclonal Antibody

Print Print
Please log in

Cat# 128855-Biotin-100ul

Size : 100ul

Brand : US Biological

Request more information

128855-Biotin KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (Biotin)

Clone Type
Polyclonal
Host
mouse
Source
human
Isotype
IgG2b,k
Grade
Affinity Purified
Applications
E WB
Crossreactivity
Hu
Accession #
NM_001730, NP_001721
Shipping Temp
Blue Ice
Storage Temp
-20°C

KLF5 is a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, the protein is thought to be a transcription factor.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN

Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.  For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. 

Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG2b,k|Clone No: 2G12|Host: mouse|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa358-457 from human KLF5 (NP_001721) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human KLF5.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa358-457 from human KLF5 (NP_001721) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human KLF5.