- More Files
- Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant BRCA1.
Immunogen
BRCA1 (NP_009225, 1581 a.a. ~ 1670 a.a) partial recombinant protein with GST tag.
Sequence
EDRAPESARVGNIPSSTSALKVPQLKVAESAQGPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFAR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.01 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Recombinant protein)
ELISA
- Gene Info — BRCA1
Entrez GeneID
672GeneBank Accession#
NM_007294Protein Accession#
NP_009225Gene Name
BRCA1
Gene Alias
BRCAI, BRCC1, IRIS, PSCP, RNF53
Gene Description
breast cancer 1, early onset
Omim ID
113705Gene Ontology
HyperlinkGene Summary
This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified. [provided by RefSeq
Other Designations
BRCA1/BRCA2-containing complex, subunit 1|breast and ovarian cancer susceptibility protein 1
- Interactome
- Pathway
- Disease