Coronavirus IBV nsp4 Gene Tagged ORF Clone

CAT#: VC102255

  • TrueORF®

Myc-DDK-tagged ORF clone for coronavirus nsp4 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740625


Product Images

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Symbol coronavirus nsp4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC102255 represents NCBI reference of NP_740625 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTAAGCTCAGCGACGTTAAATGCACCACTGTAGTTCTCATGCAGCTCCTCACCAAGCTGAACGTGG
AAGCTAACAGTAAAATGCACGTGTACCTGGTCGAACTCCACAATAAGATCCTCGCTAGTGACGATGTGGG
TGAATGCATGGATAACCTGCTCGGCATGCTGATAACGCTGTTCTGCATTGACTCAACCATTGACCTGTCC
GAGTACTGCGACGACATACTGAAGCGCTCTACCGTCCTCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC102255 representing NP_740625
Red=Cloning sites Green=Tags

MAKLSDVKCTTVVLMQLLTKLNVEANSKMHVYLVELHNKILASDDVGECMDNLLGMLITLFCIDSTIDLS
EYCDDILKRSTVLQ

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_001451
ORF Size 252 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at info@biotrend-usa.com

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NC_001451.1, NP_740625
RefSeq ORF 252 bp
MW 9.4 kDa

Other Versions