- More Files
- Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GBA.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
GBA (NP_000148.2, 146 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (88)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Western Blot (Cell lysate)
GBA monoclonal antibody (M01J), clone 2E2. Western Blot analysis of GBA expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of GBA expression in transfected 293T cell line by GBA monoclonal antibody (M01J), clone 2E2.
Lane 1: GBA transfected lysate (Predicted MW: 59.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GBA on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GBA is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GBA on HeLa cell . [antibody concentration 20 ug/ml] - Gene Info — GBA
Entrez GeneID
2629GeneBank Accession#
NM_000157.1Protein Accession#
NP_000148.2Gene Name
GBA
Gene Alias
GBA1, GCB, GLUC
Gene Description
glucosidase, beta; acid (includes glucosylceramidase)
Gene Ontology
HyperlinkGene Summary
This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq
Other Designations
D-glucosyl-N-acylsphingosine glucohydrolase|OTTHUMP00000033992|OTTHUMP00000033993|glucocerebrosidase|glucocerebrosidase (alt.)|lysosomal glucocerebrosidase
- Interactome
- Pathway
- Disease