HOXC5 antibody

Cat# orb573775-100ul

Size : 100ul

Brand : Biorbyt


    HOXC5 antibody

    HOXC5 antibody

    Catalog Number: orb573775

    Catalog Numberorb573775
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to HOXC5
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Predicted ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
    ReactivityAnimal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish
    ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HOXC5
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW25kDa
    TargetHOXC5
    UniProt IDQ00444
    Protein SequenceSynthetic peptide located within the following region: WMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNL
    NCBINP_061826
    StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesCP11, HOX3, HOX3D
    NoteFor research use only
    Expiration Date12 months from date of receipt.